To install click the Add extension button. That's it.

The source code for the WIKI 2 extension is being checked by specialists of the Mozilla Foundation, Google, and Apple. You could also do it yourself at any point in time.

4,5
Kelly Slayton
Congratulations on this excellent venture… what a great idea!
Alexander Grigorievskiy
I use WIKI 2 every day and almost forgot how the original Wikipedia looks like.
Live Statistics
English Articles
Improved in 24 Hours
Added in 24 Hours
Languages
Recent
Show all languages
What we do. Every page goes through several hundred of perfecting techniques; in live mode. Quite the same Wikipedia. Just better.
.
Leo
Newton
Brights
Milds

From Wikipedia, the free encyclopedia

C17orf98
Identifiers
AliasesC17orf98, chromosome 17 open reading frame 98
External IDsMGI: 1919465; HomoloGene: 19140; GeneCards: C17orf98; OMA:C17orf98 - orthologs
Orthologs
SpeciesHumanMouse
Entrez
Ensembl
UniProt
RefSeq (mRNA)

NM_001080465

NM_028156

RefSeq (protein)

NP_001073934

NP_082432

Location (UCSC)Chr 17: 38.84 – 38.84 MbChr 11: 97.66 – 97.67 Mb
PubMed search[3][4]
Wikidata
View/Edit HumanView/Edit Mouse

C17orf98 is a protein which in humans is coded by the gene c17orf98. The protein is derived from Homo sapiens chromosome 17.[5] The C17orf98 gene consists of a 6,302 base sequence. Its mRNA has three exons and no alternative splice sites. The protein has 154 amino acids, with no abnormal amino acid levels.[6] C17orf98 has a domain of unknown function (DUF4542) and is 17.6kDa in weight.[7][8] C17orf98 does not belong to any other families nor does it have any isoforms.[9] The protein has orthologs with high percent similarity in mammals and reptiles. The protein has additional distantly related orthologs across the metazoan kingdom, culminating with the sponge family.[10]

Like most proteins, C17orf98 is known to be highly expressed in the testes.[11] The protein has also been known to have elevated levels in cancer.[11] The protein has been shown to be expressed in proximity to or within intermediate filaments and the nucleolus.[11] Additionally, c17orf98 has transcription factors which are also active in hematopoietic stem cells, the immune system, and the cardiovascular system, among others.[12] The gene is over-expressed in many cancer types, including kidney renal clear cell carcinoma and lung squamous cell carcinoma.[13] Motif and transcription factor analysis points towards c17orf98 playing a role in proliferation, specially in immune cell proliferation.

Gene

Background

The C17orf98 gene consists of 6,303 bases. It has three exons and two large introns. The gene has no alternative splice sites.[14] The 5' UTR sequence of C17orf98 is highly conserved in primates. No non-mammalian 5' UTR matches were able to be determined.[15][16] C17orf98 has 11 Alu repeats.[17]

Enhancers

GeneCards determined that C17orf98 has five enhancer sequences. The role of the sequences may provide insight into the function of C17orf98. Four of the five enhancers are active in the thymus. All five enhancers are active in the H1 hESC. Additionally, all five enhancers are active in iPS DF 19.11 derived from foreskin fibroblasts.[18]

Transcription factors

The C17orf98 promoter has many transcription factors binding sites.[19] C17orf98's transcription factors are commonly found in hematopoietic cells, connective tissue, cardiovascular tissue, and the immune system. The presence of Krueppel Like Transcription Factors suggests a role for c17orf 98 in proliferation or apoptosis. The presence of SMAD indicates an involvement in the TGF-β pathway, while the presence of Myc related transcription factors indicates a potential proliferation function of the protein. Additionally, other C17orf98 transcription factors, like RBPJ-Kappa are involved in proliferation and signalling.

Variants

Numerous SNPs were found in the 5' UTR, 3' UTR, and coding region of c17orf98.[20] Few SNPs were found in highly conserved regions. In all, four SNPs were found in the highly conserved amino acids. One SNP was found in the start codon sequence. Of these five, three had a SNP on the third position of the codon. Due to the wobble hypothesis, three of the five SNPs would have no effect on the overall protein structure.

mRNA

C17orf98 does not have any miRNA binding sites.[21] Its mRNA has low abundance (0.44%).[22] The mRNA sequence has three hexaloops, none of which are significant.[23]

Protein

Primary structure

C17orf98 is a 17.6kDa protein.[8] Distant orthologs are 5 to 6 kDa larger, but some of the discrepancies come from an added NLS sequence, which Homo sapiens does not have There are no positive or negative charge clusters. There are no transmembrane components. The isoelectric point is 9.80 / 17564.67 pI/Mw.[24] C17orf98 is hydrophobic and soluble.

Secondary structure and phosphorylation sites

Secondary and tertiary structure

Secondary structure of c17orf98 consists of both beta sheets and alpha helices (see diagram on right). Results are confirmed in the tertiary structure, however, alpha helix and beta sheet numbers differ slightly (see diagram on right).

Motifs and binding sites

There are no N-terminal signal peptides. Cleavage motifs were not found. There are no ER membrane retention signals, nor peroxisomal targeting signal. SKL2 is not present, thus a secondary peroxisome signal is not present. There are no vacuolar targeting signals. There are no RNA binding motifs or actinin type actin binding motifs. There are no N-myristoylation pattern or prenylation patterns.[25]

SWISS-MODEL 3D structure of c17orf98

Kinase finder at Cuckoo determined kinase binding sites for c17orf98. There are many Serine/Threonine, and Tyrosine kinase phosphorylation sites.[26] Serine and Threonine kinase binding sites are the most prevalent above the statistically significant threshold. There are no SUMOylation sites.[27] C17orf98 gene has six sites on the sequence of possible O-GlcNAc sites.[28] Highly conserved O-GlcNAc amino acid sites are 24, 32, 117, and 142. O-GlcNAc post-translational modification occurs on Ser/Thr residues, specifically on oncogenes, tumor suppressors, and proteins involved in growth factor signaling.[29]

C17orf98 has a Caspase3/7 motif, where either Caspase 3 or 7 would cleave.[30] This supports the idea that C17orf98 is involved in proliferation, as a proapoptotic caspase would want to destroy any protein driving proliferation. The protein also has a motif where peptidyl-prolyl cis-trans isomerase NIMA interacting 1 (Pin1) binds.[30] Pin1 upregulation is involved in cancer and immune disorders.[31] This supports the claim that C17orf98 is involved in cancer, immune cells, and perhaps cancers of the immune system. Additionally, C17orf98 protein has an IBM site, where inhibitors of apoptosis (IAPs) bind.[30] This again supports the idea of C17orf98 being involved in inhibiting apoptosis, and logically, driving cancer. Furthermore, C17orf98 has motifs where GRB2's SH2 domain binds. GRB2 is an adapter protein involved in the RAS signaling pathway, a pathway that when deregulated drives uncontrolled proliferation.

Amino acid sequence

A duplication may have occurred at positions 59–71.

Homo sapiens

MAYLSECRLRLEKGFILDGVAVSTAARAYGRSRPKLWSAIPPYNAQQDYHARSYFQ SHVVPPLLRVVPPLLRKTDQDHGGTGRDGWIVDYIHIFGQGQRYLNRRNWAGTGHS LQQVTGHDHYNADLKPIDGFNGRFGYRRNTPALRQSTSVFGEVTHFPLF

Associated proteins

There are no known associated proteins.[32][33][34][35]

Expression

Protein abundance in Homo sapiens whole organism is quite low. No data is available for other species.[36] Allen Brain Atlas yields no brain atlas for c17orf98.[37]

Subcellular localization

C17orf98 protein has been found to be expressed in the intermediate filaments and the nucleoli.[38] A C17orf98 antibody is available from Sigma-Aldrich.[39] Additionally, C17orf98 localizes in the cytoplasm. Distantly related c17orf98 orthologs in organisms such as Macrostomum lignano and Amphimedon queenslandica exhibit nuclear expression.[40] Nuclear localization signals are present in distantly related organisms in non-conserved sites. The results of the k-NN prediction is cytoplasmic localization.[41] C17orf98 is not a signal peptide.[42] The protein is a soluble.[43]

Tissue

Like most proteins, C17orf98 protein is highly expressed in the testes.[44] The protein is expressed on adult tissues as well as fetal tissue. The protein has been found to be mildly expressed in connective tissue.[45] Additionally, expression has been seen in the sperm, breast epithelial cells, and various cells of the immune system.[46]

Clinical significance

Cancer

Protein expression is elevated in many cancer patients. Specifically, protein expression has been shown to be high on colorectal, breast, prostate, and lung.[47] C17orf98 is expressed in papillary thyroid cancer as well.[48] Additionally, mutations were found in c17orf98 in endometrial, stomach, coloratura, and kidney cancer.[49] C17orf98 expression is elevated in cancer patients with BRCA. In kidney renal clear cell carcinoma patients, c17orf98 expression dramatically decreased compared to the non cancerous state.[13] In 80% of chromophobe renal cell carcinoma patients, at least one gene duplication c17orf98 was present.[13]

Other conditions

Protein expression is lower in males with teratozoospermia as compared to those without.[50] Many Geo Profile experiments have been conducted with C17orf98, however, none yield data showing significant change in expression.[51]

Evolution

C17orf98 is a slow mutating protein. It resembles cytochrome c in its rate of divergence, as determined by the molecular clock equations.[52]

Unrooted c17orf98 Phylogenetic Tree with 20 orthologs (see table below)

Paralogs

There are no known Homo sapiens paralogs for C17orf98.[53]

Orthologs

C17orf98 protein has additional distantly related orthologs across the metazoan kingdom. Its most distant relative is in the sponge family. There is no known ortholog in ctenophores, nematodes, bacteria, fungus, plants, or zebrafish.[10] There are only two fish with the C17orf 98 gene. Model organisms such as Caenorhabditis elegans, and Drosophila melanogaster, do not have the gene.

C17orf98 Orthologs[10]

Sequence # Genus and species Common name Accession # Protein length MYA Div Seq Id Confidence
1 Homo sapiens Human NP_001073934 154 0 100% na
2 Camelus ferus Wild Bactrian camel XP_006176436 154 96 83% 2.00E-94
3 Pteropus alecto Black flying fox XP_006924784 154 96 81% 1.00E-92
4 Lipotes vexilifer Yangtze river dolphin XP_007465208 154 96 81% 6.00E-89
5 Condylura cristat Star-nosed mole XP_004684322 154 96 75% 5.00E-78
6 Myotis brandtii Brandt's bat EPQ05064 171 96 78% 6.00E-78
7 Marmata marmata marmata Alpine marmot XP_015362150.1 154 90 81% 3.00E-94
8 Octodon degus Chilean rodent XP_004633931 153 90 73% 1.00E-76
9 Alligator sinensis Chinese alligator XP_006022630 154 312 63% 8.00E-68
10 Anolis carolinensis Lizard XP_003222553 154 312 62% 6.00E-67
11 Xenopus laevis African clawed frog XP_018090228 244 352 51% 4.00E-38
12 Rhincodon typus Whale shark XP_020388051.1 164 476 53% 5.00E-52
13 Acanthaster planci Starfish XP_022086463 209 684 48% 1.00E-37
14 Mizuhopecten yessoensis Scallop XP_021340301 275 797 45% 5.00E-06
15 Lottia gigantea Sea snail XP_009063876 173 797 45% 2.00E-37
16 Lingula anatine Lamp shell XP_013388744.1 211 797 43% 2.00E-35
17 Biomphalaria glabrata Freshwater snail XP_013088317 198 797 41% 6.00E-15
18 Nematostella vectensis Sea anemone XP_001629616 173 824 48% 2.00E-35
19 Stylophora pistillata Coral XP_022795125 226 824 46% 3.00E-38
20 Macrostonum lignano Flatworm PAA73615 235 824 36% 4.00E-25
21 Amphimedon queenslandica Sponge XP_003389909 275 951.8 32% 2.00E-12

References

  1. ^ a b c ENSG00000276913 GRCh38: Ensembl release 89: ENSG00000275489, ENSG00000276913Ensembl, May 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000018543Ensembl, May 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, et al. (April 2006). "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage". Nature. 440 (7087): 1045–9. Bibcode:2006Natur.440.1045Z. doi:10.1038/nature04689. PMC 2610434. PMID 16625196.
  6. ^ PSORT II entry on c17orf98 https://psort.hgc.jp/form2.html
  7. ^ NCBI Conserved Domains entry C17orf98
  8. ^ a b ENMBL-EBI SAPS entry on c17orf98
  9. ^ "BLAST: Basic Local Alignment Search Tool". blast.ncbi.nlm.nih.gov. Retrieved 2 May 2018.
  10. ^ a b c "Protein BLAST: search protein databases using a protein query". blast.ncbi.nlm.nih.gov. Retrieved 2 May 2018.
  11. ^ a b c Human protein atlas entry on c17orf98
  12. ^ Genomatix El Derado etnry on c17orf98
  13. ^ a b c TissGDB entry on c17orf98
  14. ^ Acieview entry on c17orf98
  15. ^ ClustalW entry on c17orf98 5' UTR
  16. ^ NCBI Blast entry on c17orf98 5' UTR https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastn&PAGE_TYPE=BlastSearch&LINK_LOC=blastho me
  17. ^ Genomatix El Derado etnry on c17orf98[permanent dead link]
  18. ^ Database, GeneCards Human Gene. "C17orf98 Gene - GeneCards - CQ098 Protein - CQ098 Antibody". www.genecards.org. Retrieved 2 May 2018.
  19. ^ "Genomatix El Derado etnry on c17orf98".[permanent dead link]
  20. ^ NCBI Genome Data Viewer
  21. ^ Target Scan entry on c17orf98 http://www.targetscan.org/cgibin/targetscan/vert_71/view_gene.cgi?rs=ENST00000398575.4&taxid=9606&showcnc=0&shownc=0&shownc_nc=&showncf1=&showncf2=&subset=1[permanent dead link]
  22. ^ Pax-db entry on c17orf98
  23. ^ "mFold entry on c17orf98 5' UTR".[permanent dead link]
  24. ^ ExPASy pI/mW entry on c17orf98 https://web.expasy.org/cgi-bin/compute_pi/pi_tool[permanent dead link]
  25. ^ PSort II entry on C17orf98[permanent dead link]
  26. ^ Bio Cockoo GPS entry on C17orf98 http://gps.biocu[permanent dead link]
  27. ^ GPS Sumo entry on c17orf98
  28. ^ YinOyang entry on c17orf98 http://www.cbs.dtu.dk/services/YinOYang/
  29. ^ Hanover, John A.; Krause, Michael W.; Love, Dona C. (2010). "The Hexosamine Signaling Pathway: O-GlcNAc cycling in feast or famine". Biochimica et Biophysica Acta (BBA) - General Subjects. 1800 (2): 80–95. doi:10.1016/j.bbagen.2009.07.017. PMC 2815088. PMID 19647043.
  30. ^ a b c Eukaryotic Linear Motif search on c17orf98 amino acid sequence
  31. ^ Esnault S, Braun RK, Shen ZJ, Xiang Z, Heninger E, Love RB, Sandor M, Malter JS (February 2007). "Pin1 modulates the type 1 immune response". PLOS ONE. 2 (2): e226. Bibcode:2007PLoSO...2..226E. doi:10.1371/journal.pone.0000226. PMC 1790862. PMID 17311089.
  32. ^ BioGrid entry on c17orf98
  33. ^ MINT entry on c17orf98
  34. ^ STRING entry on C17orf98
  35. ^ PSICQUIC View entry on c17orf98
  36. ^ pax-db entry on c17orf98 https://pax-db.org/protein/1858623#
  37. ^ "Microarray Data :: Allen Brain Atlas: Human Brain". human.brain-map.org. Retrieved 2018-05-06.
  38. ^ Human Protein Atlas (sigma) entry on c17orf98 https://www.proteinatlas.org/ENSG00000275489-C17orf98/cell[permanent dead link]
  39. ^ Sigma Aldrich entry on c17orf98 https://www.sigmaaldrich.com/catalog/product/sigma/hpa051696?lang=en&region=US
  40. ^ PSORT II entry on c17orf98 amino acid sequence https://psort.hgc.jp/form2.html
  41. ^ PSort II entry on C17orf98 https://psort.hgc.jp/cgi-bin/runpsort.pl[permanent dead link]
  42. ^ DTU Bioinformatics entry on c17orf98
  43. ^ Expasy Sosui entry on C17orf98
  44. ^ Protein Atlas entry on c17orf98
  45. ^ NCBI Unigene entry on c17orf98 www.ncbi.nlm.nih.gov/UniGene/clust.cgi?UGID=169593&TAXID=9606&SEARCH=c17orf98
  46. ^ "Bio GPS entry on c17orf98".
  47. ^ Human Protein Atlas (sigma) entry on c17orf98 https://www.proteinatlas.org/ENSG00000275489-C17orf98/cell
  48. ^ NCBI GeoProfiles entry on c17orf98 https://www.ncbi.nlm.nih.gov/geoprofiles
  49. ^ Phosphosite entry on c17orf98 https://www.phosphosite.org/proteinAction.action?id=5156341&showAllSites=true
  50. ^ "C17orf98 - Teratozoospermia (HG-U133 2.0 )".
  51. ^ "NCBI GeoProfiles entry on c17orf98".
  52. ^ "The Molecular Clock and Estimating Species Divergence - Learn Science at Scitable". www.nature.com. Retrieved 2 May 2018.
  53. ^ Blast entry on c17orf98 https://blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE=Proteins
This page was last edited on 2 March 2023, at 03:42
Basis of this page is in Wikipedia. Text is available under the CC BY-SA 3.0 Unported License. Non-text media are available under their specified licenses. Wikipedia® is a registered trademark of the Wikimedia Foundation, Inc. WIKI 2 is an independent company and has no affiliation with Wikimedia Foundation.